PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.241880.1
Common NameCsa_3G782620, LOC101208201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 717aa    MW: 78724.2 Da    PI: 7.2451
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.241880.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.5e-094014381954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Cucsa.241880.1 401 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 438
                     664459******************************88 PP

2BELL1246.1e-40265336172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqe+q+kkakL+s+leeV++rY+qy++q+q+vissFe++ag gsa+ Yt+lAl++iS++FrcLkdai++qi
  Cucsa.241880.1 265 ERQEIQMKKAKLISMLEEVEQRYRQYHHQMQIVISSFEQAAGAGSARTYTALALQTISKQFRCLKDAITGQI 336
                     79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.3E-60188334IPR006563POX domain
PfamPF075261.3E-48193333IPR006563POX domain
PROSITE profilePS5007112.163379442IPR001356Homeobox domain
SMARTSM003896.4E-9382446IPR001356Homeobox domain
CDDcd000862.06E-11382443No hitNo description
SuperFamilySSF466894.28E-17383449IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.2E-29385449IPR009057Homeodomain-like
PfamPF059203.0E-18399438IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 717 aa     Download sequence    Send to blast
MATYLHGNSD QFQSSDGGLQ TLVLMNPTYV QFSDTTPPPP PPPSHPNLLF FNSPSSTANT  60
FTTLVQPPPS SHTQQFVGIP LQTTSAASPT SQDHNSHPLN PHHDISPLHG FVPRLQHNIW  120
NQIDPSTAAR DSARAQQGLS LTLSSQHQQA FGSRDVQSQN QQALSGEDNM RISGGSSSSA  180
SGVTNGVAGI QGVLISSKYL KATQELLDEV VNVTQNGIKS ESSPKKATGN QSKMIGDAAA  240
ATGTADGSLE GEADGKQAAE LTTSERQEIQ MKKAKLISML EEVEQRYRQY HHQMQIVISS  300
FEQAAGAGSA RTYTALALQT ISKQFRCLKD AITGQIRAAN KSLGEEECIG RKVEGSRLKF  360
VDHHLRQQRA LQQLGMIQHN AWRPQRGLPE RSVSILRAWL FEHFLHPYPK DSDKHMLAKQ  420
TGLTRSQVSN WFINARVRLW KPMVEEMYME EIKDQEQNGN GSTPTTEKSN DDSVSKSIAP  480
PPETKSPNSK QENSPNQNVH PSISISNSSG GNVRNSSGFT LIGTSSELDG ITQGSPKKQR  540
GPDILHSSNN NVPFINMDIK PREEEEHQNQ NHNPHQNNHH HHHHLLPMKF DEDRQNRDGY  600
SFLGQPHFNI GGFGQYPIGE IARFDADQFT PRFSGNNGVS LTLGLPHCEN LSLNPATHQS  660
FLPNQSIHLG RRTEIGKPTD FSAINASTAH SSTAFETINI QNGKRFAAQL LPDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16388446563Homeobox protein Meis2
3k2a_B4e-16388446563Homeobox protein Meis2
4xrm_A5e-16388446563Homeobox protein Meis2
4xrm_B5e-16388446563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004136516.20.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_011652036.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A0A0LE650.0A0A0A0LE65_CUCSA; Uncharacterized protein
STRINGPOPTR_0006s21950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16273492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-167BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]